Lineage for d5u82a2 (5u82 A:81-208)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2617286Fold d.357: NosL/MerB-like [160386] (1 superfamily)
    unusual fold; comprises two structural repeats of beta(2)-alpha-beta motifs, forming separate beta-sheets; probable duplication
  4. 2617287Superfamily d.357.1: NosL/MerB-like [160387] (2 families) (S)
  5. 2617293Family d.357.1.2: MerB-like [160391] (1 protein)
    Pfam PF03243
  6. 2617294Protein Alkylmercury lyase MerB [160392] (1 species)
  7. 2617295Species Escherichia coli [TaxId:562] [160393] (17 PDB entries)
    Uniprot P77072 81-212
  8. 2617318Domain d5u82a2: 5u82 A:81-208 [328354]
    Other proteins in same PDB: d5u82a1, d5u82b1
    automated match to d1s6la2
    complexed with act, br, zn0

Details for d5u82a2

PDB Entry: 5u82 (more details), 1.85 Å

PDB Description: crystal structure of a merb-triethyltin complex
PDB Compounds: (A:) Alkylmercury lyase

SCOPe Domain Sequences for d5u82a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u82a2 d.357.1.2 (A:81-208) Alkylmercury lyase MerB {Escherichia coli [TaxId: 562]}
tsyvfeiddrrlyawcaldtlifpaligrtarvsshcaatgapvsltvspseiqavepag
mavslvlpqeaadvrqsfcchvhffasvptaedwaskhqgleglaivsvheafglgqefn
rhllqtms

SCOPe Domain Coordinates for d5u82a2:

Click to download the PDB-style file with coordinates for d5u82a2.
(The format of our PDB-style files is described here.)

Timeline for d5u82a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5u82a1