Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (12 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (15 proteins) |
Protein Class pi GST [81358] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [52864] (33 PDB entries) |
Domain d2gssa2: 2gss A:2-76 [32834] Other proteins in same PDB: d2gssa1, d2gssb1 |
PDB Entry: 2gss (more details), 1.9 Å
SCOP Domain Sequences for d2gssa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gssa2 c.47.1.5 (A:2-76) Class pi GST {Human (Homo sapiens)} pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt lyqsntilrhlgrtl
Timeline for d2gssa2: