SCOPe 2.07: Domain d5u79a1: 5u79 A:1-80

Lineage for d5u79a1 (5u79 A:1-80)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.79: MerB N-terminal domain-like [158323] (1 protein)

6. Protein Alkylmercury lyase MerB [158324] (1 species)

7. Species Escherichia coli [TaxId:562] [158325] (17 PDB entries)
   Uniprot P77072 21-80

8. Domain d5u79a1: 5u79 A:1-80 [328322]
   Other proteins in same PDB: d5u79a2, d5u79b2
   automated match to d1s6la1
   complexed with act, br, zn5

Details for d5u79a1

PDB Entry: 5u79, 1.6 Å

PDB Description: crystal structure of a complex formed between merb and dimethyltin

PDB Compounds: (A:) Alkylmercury lyase

SCOPe Domain Sequences for d5u79a1:

Sequence; same for both SEQRES and ATOM records:

>d5u79a1 a.4.5.79 (A:1-80) Alkylmercury lyase MerB {Escherichia coli [TaxId: 562]}
mklapyilelltsvnrtngtadllvpllrelakgrpvsrttlagildwpaervaavleqa
tsteydkdgniigygltlre

Timeline for d5u79a1:

• d5u79a1 first appeared in SCOPe 2.06
  
• d5u79a1 appears in the current release, SCOPe 2.08