Lineage for d9gssa2 (9gss A:2-76)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 991973Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 991974Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 992315Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 992593Protein Class pi GST [81358] (4 species)
  7. 992594Species Human (Homo sapiens) [TaxId:9606] [52864] (41 PDB entries)
  8. 992621Domain d9gssa2: 9gss A:2-76 [32830]
    Other proteins in same PDB: d9gssa1, d9gssb1
    complexed with gtx, mes, so4

Details for d9gssa2

PDB Entry: 9gss (more details), 1.97 Å

PDB Description: human glutathione s-transferase p1-1, complex with s-hexyl glutathione
PDB Compounds: (A:) glutathione s-transferase p1-1

SCOPe Domain Sequences for d9gssa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d9gssa2 c.47.1.5 (A:2-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
lyqsntilrhlgrtl

SCOPe Domain Coordinates for d9gssa2:

Click to download the PDB-style file with coordinates for d9gssa2.
(The format of our PDB-style files is described here.)

Timeline for d9gssa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d9gssa1