SCOP 1.61: Domain d6gssa2: 6gss A:2-76

Lineage for d6gssa2 (6gss A:2-76)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (12 families)

5. Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)

6. Protein Glutathione S-transferase [52863] (27 species)

7. Species Human (Homo sapiens), class pi [TaxId:9606] [52864] (33 PDB entries)

8. Domain d6gssa2: 6gss A:2-76 [32828]
   Other proteins in same PDB: d6gssa1, d6gssb1

Details for d6gssa2

PDB Entry: 6gss, 1.9 Å

PDB Description: human glutathione s-transferase p1-1, complex with glutathione

SCOP Domain Sequences for d6gssa2:

Sequence; same for both SEQRES and ATOM records:

>d6gssa2 c.47.1.5 (A:2-76) Glutathione S-transferase {Human (Homo sapiens), class pi}
pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
lyqsntilrhlgrtl

Timeline for d6gssa2:

• d6gssa2 first appeared (with stable ids) in SCOP 1.55
  
• d6gssa2 appears in SCOP 1.59
  
• d6gssa2 appears in SCOP 1.63
  
• d6gssa2 appears in the current release, SCOPe 2.08