Lineage for d13gsa2 (13gs A:0-76)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 486470Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 486471Superfamily c.47.1: Thioredoxin-like [52833] (15 families) (S)
  5. 486664Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)
  6. 486885Protein Class pi GST [81358] (3 species)
  7. 486886Species Human (Homo sapiens) [TaxId:9606] [52864] (36 PDB entries)
  8. 486900Domain d13gsa2: 13gs A:0-76 [32824]
    Other proteins in same PDB: d13gsa1, d13gsb1

Details for d13gsa2

PDB Entry: 13gs (more details), 1.9 Å

PDB Description: glutathione s-transferase complexed with sulfasalazine

SCOP Domain Sequences for d13gsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d13gsa2 c.47.1.5 (A:0-76) Class pi GST {Human (Homo sapiens)}
mppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgd
ltlyqsntilrhlgrtl

SCOP Domain Coordinates for d13gsa2:

Click to download the PDB-style file with coordinates for d13gsa2.
(The format of our PDB-style files is described here.)

Timeline for d13gsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d13gsa1