Lineage for d13gsa2 (13gs A:0-76)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 70801Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 70802Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 70930Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (3 proteins)
  6. 70934Protein Glutathione S-transferase [52863] (24 species)
  7. 71005Species Human (Homo sapiens), class pi [TaxId:9606] [52864] (30 PDB entries)
  8. 71017Domain d13gsa2: 13gs A:0-76 [32824]
    Other proteins in same PDB: d13gsa1, d13gsb1

Details for d13gsa2

PDB Entry: 13gs (more details), 1.9 Å

PDB Description: glutathione s-transferase complexed with sulfasalazine

SCOP Domain Sequences for d13gsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d13gsa2 c.47.1.5 (A:0-76) Glutathione S-transferase {Human (Homo sapiens), class pi}
mppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgd
ltlyqsntilrhlgrtl

SCOP Domain Coordinates for d13gsa2:

Click to download the PDB-style file with coordinates for d13gsa2.
(The format of our PDB-style files is described here.)

Timeline for d13gsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d13gsa1