Lineage for d1aqwd2 (1aqw D:1-76)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1600814Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 1601129Protein Class pi GST [81358] (4 species)
  7. 1601130Species Human (Homo sapiens) [TaxId:9606] [52864] (49 PDB entries)
  8. 1601210Domain d1aqwd2: 1aqw D:1-76 [32814]
    Other proteins in same PDB: d1aqwa1, d1aqwb1, d1aqwc1, d1aqwd1
    complexed with gsh, mes

Details for d1aqwd2

PDB Entry: 1aqw (more details), 1.8 Å

PDB Description: glutathione s-transferase in complex with glutathione
PDB Compounds: (D:) glutathione s-transferase

SCOPe Domain Sequences for d1aqwd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aqwd2 c.47.1.5 (D:1-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
tlyqsntilrhlgrtl

SCOPe Domain Coordinates for d1aqwd2:

Click to download the PDB-style file with coordinates for d1aqwd2.
(The format of our PDB-style files is described here.)

Timeline for d1aqwd2: