Lineage for d5ghmb_ (5ghm B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2577867Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2577868Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2577869Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2577870Protein 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 [103207] (2 species)
  7. 2577871Species Human (Homo sapiens) [TaxId:9606] [103208] (79 PDB entries)
  8. 2577908Domain d5ghmb_: 5ghm B: [327940]
    automated match to d1irya_
    protein/DNA complex; complexed with 8dg, na; mutant

Details for d5ghmb_

PDB Entry: 5ghm (more details), 1.5 Å

PDB Description: crystal structure of human mth1(g2k/d120n mutant) in complex with 8- oxo-dgtp at ph 7.0
PDB Compounds: (B:) 7,8-dihydro-8-oxoguanine triphosphatase

SCOPe Domain Sequences for d5ghmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ghmb_ d.113.1.1 (B:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]}
mkasrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesglt
vdalhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpdn
sywfplllqkkkfhgyfkfqgqdtildytlrevdtv

SCOPe Domain Coordinates for d5ghmb_:

Click to download the PDB-style file with coordinates for d5ghmb_.
(The format of our PDB-style files is described here.)

Timeline for d5ghmb_: