SCOPe 2.06: Domain d1jhba_: 1jhb A:

Lineage for d1jhba_ (1jhb A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Glutaredoxin (Grx, thioltransferase) [52843] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52848] (2 PDB entries)

8. Domain d1jhba_: 1jhb A: [32772]

Details for d1jhba_

PDB Entry: 1jhb

PDB Description: human glutaredoxin in fully reduced form, nmr, 20 structures

PDB Compounds: (A:) glutaredoxin

SCOPe Domain Sequences for d1jhba_:

Sequence; same for both SEQRES and ATOM records:

>d1jhba_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Human (Homo sapiens) [TaxId: 9606]}
aqefvnckiqpgkvvvfikptcpycrraqeilsqlpikqgllefvditatnhtneiqdyl
qqltgartvprvfigkdciggcsdlvslqqsgelltrlkqigalq

Timeline for d1jhba_:

• d1jhba_ first appeared (with stable ids) in SCOP 1.55, called d1jhb__
  
• d1jhba_ appears in SCOPe 2.05
  
• d1jhba_ appears in SCOPe 2.07
  
• d1jhba_ appears in the current release, SCOPe 2.08