Lineage for d1fova_ (1fov A:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) Superfamily c.47.1: Thioredoxin-like [52833] (12 families) 
Family c.47.1.1: Thioltransferase [52834] (6 proteins) Protein Glutaredoxin (Thioltransferase) [52843] (5 species) 
Species Escherichia coli, GRX3 [TaxId:562] [52846] (2 PDB entries) 
Domain d1fova_: 1fov A: [32770]
Details for d1fova_
PDB Entry: 1fov (more details)
PDB Description: glutaredoxin 3 from escherichia coli in the fully oxidized form
SCOP Domain Sequences for d1fova_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fova_ c.47.1.1 (A:) Glutaredoxin (Thioltransferase) {Escherichia coli, GRX3}
anveiytketcpychrakallsskgvsfqelpidgnaakreemikrsgrttvpqifidaq
higgyddlyaldarggldpllk
SCOP Domain Coordinates for d1fova_:
Click to download the PDB-style file with coordinates for d1fova_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fova_:
- d1fova_ first appeared (with stable ids) in SCOP 1.55
- d1fova_ appears in SCOP 1.57
- d1fova_ appears in SCOP 1.61
- d1fova_ appears in the current release, SCOPe 2.08
View in 3D