Lineage for d5ltpe1 (5ltp E:1-219)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546826Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2546827Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2547682Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2547683Protein automated matches [190526] (25 species)
    not a true protein
  7. 2547694Species Amphioxus (Branchiostoma lanceolatum) [TaxId:7740] [227942] (7 PDB entries)
  8. 2547706Domain d5ltpe1: 5ltp E:1-219 [327462]
    Other proteins in same PDB: d5ltpb2, d5ltpc2, d5ltpd2, d5ltpe2, d5ltpf2
    automated match to d3neda_
    complexed with cl, flc

Details for d5ltpe1

PDB Entry: 5ltp (more details), 1.7 Å

PDB Description: structure of the yellow-green fluorescent protein mneongreen from branchiostoma lanceolatum at the acidic ph 4.5
PDB Compounds: (E:) mNeonGreen

SCOPe Domain Sequences for d5ltpe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ltpe1 d.22.1.0 (E:1-219) automated matches {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}
aslpathelhifgsingvdfdmvgqgtgnpndgyeelnlkstkgdlqfspwilvphigyg
fhqylpypdgmspfqaamvdgsgyqvhrtmqfedgasltvnyrytyegshikgeaqvkgt
gfpadgpvmtnsltaadwcrskktypndktiistfkwsyttgngkryrstarttytfakp
maanylknqpmyvfrktelkhsktelnfkewqkaftdvm

SCOPe Domain Coordinates for d5ltpe1:

Click to download the PDB-style file with coordinates for d5ltpe1.
(The format of our PDB-style files is described here.)

Timeline for d5ltpe1: