![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
![]() | Protein Thioredoxin [52835] (16 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [52842] (30 PDB entries) |
![]() | Domain d1erwa_: 1erw A: [32745] mutant |
PDB Entry: 1erw (more details), 1.8 Å
SCOPe Domain Sequences for d1erwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1erwa_ c.47.1.1 (A:) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} mvkqiesktafqealdaagdklvvvdfsatwsgpskmikpffhslsekysnviflevdvd dcqdvasecevkcmptfqffkkgqkvgefsgankekleatinelv
Timeline for d1erwa_: