SCOPe 2.07: Domain d1erva_: 1erv A:

Lineage for d1erva_ (1erv A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thioredoxin [52835] (16 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52842] (30 PDB entries)

8. Domain d1erva_: 1erv A: [32743]
   mutant

Details for d1erva_

PDB Entry: 1erv, 1.65 Å

PDB Description: human thioredoxin mutant with cys 73 replaced by ser (reduced form)

PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d1erva_:

Sequence; same for both SEQRES and ATOM records:

>d1erva_ c.47.1.1 (A:) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]}
mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
dcqdvasecevksmptfqffkkgqkvgefsgankekleatinelv

Timeline for d1erva_:

• d1erva_ first appeared (with stable ids) in SCOP 1.55, called d1erv__
  
• d1erva_ appears in SCOPe 2.06
  
• d1erva_ appears in the current release, SCOPe 2.08