![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
![]() | Protein automated matches [190057] (28 species) not a true protein |
![]() | Species Aspergillus niger [TaxId:5061] [260290] (4 PDB entries) |
![]() | Domain d5i79b1: 5i79 B:31-331 [327418] Other proteins in same PDB: d5i79a2, d5i79b2, d5i79b3 automated match to d1gzja_ complexed with ca, nag, pge; mutant |
PDB Entry: 5i79 (more details), 2.35 Å
SCOPe Domain Sequences for d5i79b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i79b1 c.1.8.3 (B:31-331) automated matches {Aspergillus niger [TaxId: 5061]} vfewfgsnesgaefgtnipgvwgtdyifpdpsaistlidkgmnffrvqfmmerllpdsmt gsydeeylanlttvikavtdggahalvdphnygryngeiisstsdfqtfwenlagqykdn dlvmfdtnneyhdmdqdlvlnlnqaaingiraagatsqyifvegnswtgawtwvdvndnm knltdpedkivyemhqyldsdgsgtsetcvsetigkervteatqwlkdnkkvgfigayag gsndvcrsavsgmleymanntdvwkgaswwaagpwwgdyifsleppdgtaytgmldilea y
Timeline for d5i79b1: