Lineage for d5i79b1 (5i79 B:31-331)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2439241Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2439898Protein automated matches [190057] (27 species)
    not a true protein
  7. 2439902Species Aspergillus niger [TaxId:5061] [260290] (4 PDB entries)
  8. 2439909Domain d5i79b1: 5i79 B:31-331 [327418]
    Other proteins in same PDB: d5i79a2, d5i79b2, d5i79b3
    automated match to d1gzja_
    complexed with ca, ctt, nag, pge; mutant

Details for d5i79b1

PDB Entry: 5i79 (more details), 2.35 Å

PDB Description: crystal structure of a beta-1,4-endoglucanase mutant from aspergillus niger in complex with sugar
PDB Compounds: (B:) Endo-beta-1, 4-glucanase

SCOPe Domain Sequences for d5i79b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i79b1 c.1.8.3 (B:31-331) automated matches {Aspergillus niger [TaxId: 5061]}
vfewfgsnesgaefgtnipgvwgtdyifpdpsaistlidkgmnffrvqfmmerllpdsmt
gsydeeylanlttvikavtdggahalvdphnygryngeiisstsdfqtfwenlagqykdn
dlvmfdtnneyhdmdqdlvlnlnqaaingiraagatsqyifvegnswtgawtwvdvndnm
knltdpedkivyemhqyldsdgsgtsetcvsetigkervteatqwlkdnkkvgfigayag
gsndvcrsavsgmleymanntdvwkgaswwaagpwwgdyifsleppdgtaytgmldilea
y

SCOPe Domain Coordinates for d5i79b1:

Click to download the PDB-style file with coordinates for d5i79b1.
(The format of our PDB-style files is described here.)

Timeline for d5i79b1: