SCOP 1.57: Domain d1fb6a_: 1fb6 A:

Lineage for d1fb6a_ (1fb6 A:)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.47: Thioredoxin fold [52832] (3 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (10 families)

5. Family c.47.1.1: Thioltransferase [52834] (5 proteins)

6. Protein Thioredoxin [52835] (7 species)

7. Species Spinach (Spinacia oleracea), thioredoxin M [TaxId:3562] [52841] (2 PDB entries)

8. Domain d1fb6a_: 1fb6 A: [32739]

Details for d1fb6a_

PDB Entry: 1fb6, 2.1 Å

PDB Description: crystal structure of thioredoxin m from spinach chloroplast (oxidized form)

SCOP Domain Sequences for d1fb6a_:

Sequence; same for both SEQRES and ATOM records:

>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M}
vqdvndsswkefvlesevpvmvdfwapwcgpckliapvidelakeysgkiavyklntdea
pgiatqynirsiptvlffkngerkesiigavpkstltdsiekyl

Timeline for d1fb6a_:

• d1fb6a_ first appeared (with stable ids) in SCOP 1.55
  
• d1fb6a_ appears in SCOP 1.59
  
• d1fb6a_ appears in the current release, SCOPe 2.08