SCOPe 2.08: Domain d1fb6a_: 1fb6 A:

Lineage for d1fb6a_ (1fb6 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thioredoxin [52835] (16 species)

7. Species Spinach (Spinacia oleracea), thioredoxin M [TaxId:3562] [52841] (3 PDB entries)

8. Domain d1fb6a_: 1fb6 A: [32739]

Details for d1fb6a_

PDB Entry: 1fb6, 2.1 Å

PDB Description: crystal structure of thioredoxin m from spinach chloroplast (oxidized form)

PDB Compounds: (A:) thioredoxin m

SCOPe Domain Sequences for d1fb6a_:

Sequence; same for both SEQRES and ATOM records:

>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]}
vqdvndsswkefvlesevpvmvdfwapwcgpckliapvidelakeysgkiavyklntdea
pgiatqynirsiptvlffkngerkesiigavpkstltdsiekyl

Timeline for d1fb6a_:

• d1fb6a_ first appeared (with stable ids) in SCOP 1.55
  
• d1fb6a_ appears in SCOPe 2.07