Lineage for d5hz6a1 (5hz6 A:4-132)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2413759Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2413760Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2414378Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2414379Protein Adipocyte lipid-binding protein, ALBP [50856] (2 species)
  7. 2414380Species Human (Homo sapiens) [TaxId:9606] [110275] (25 PDB entries)
    Uniprot P15090
  8. 2414389Domain d5hz6a1: 5hz6 A:4-132 [327140]
    Other proteins in same PDB: d5hz6a2
    automated match to d1pmpa_
    complexed with 65y

Details for d5hz6a1

PDB Entry: 5hz6 (more details), 1.14 Å

PDB Description: fabp4 in complex with 6-chloro-2-isopropyl-4-(3-isopropyl-phenyl)- quinoline-3-carboxylic acid
PDB Compounds: (A:) Fatty acid-binding protein, adipocyte

SCOPe Domain Sequences for d5hz6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hz6a1 b.60.1.2 (A:4-132) Adipocyte lipid-binding protein, ALBP {Human (Homo sapiens) [TaxId: 9606]}
afvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdvitiksestfkntei
sfilgqefdevtaddrkvkstitldggvlvhvqkwdgksttikrkreddklvvecvmkgv
tstrvyera

SCOPe Domain Coordinates for d5hz6a1:

Click to download the PDB-style file with coordinates for d5hz6a1.
(The format of our PDB-style files is described here.)

Timeline for d5hz6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5hz6a2