Lineage for d5b1da_ (5b1d A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129453Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2129454Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2129455Family c.41.1.1: Subtilases [52744] (14 proteins)
  6. 2129493Protein Proteinase K [52762] (1 species)
  7. 2129494Species Fungus (Tritirachium album), strain limber [TaxId:37998] [52763] (39 PDB entries)
    Uniprot P06873
  8. 2129532Domain d5b1da_: 5b1d A: [327120]
    automated match to d1ic6a_
    complexed with ca

Details for d5b1da_

PDB Entry: 5b1d (more details), 2.3 Å

PDB Description: crystal structure of proteinase k from engyodontium album
PDB Compounds: (A:) Proteinase K

SCOPe Domain Sequences for d5b1da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b1da_ c.41.1.1 (A:) Proteinase K {Fungus (Tritirachium album), strain limber [TaxId: 37998]}
aaqtnapwglarisstspgtstyyydesagqgscvyvidtgieashpefegraqmvktyy
yssrdgnghgthcagtvgsrtygvakktqlfgvkvlddngsgqystiiagmdfvasdknn
rncpkgvvaslslgggysssvnsaaarlqssgvmvavaagnnnadarnyspasepsvctv
gasdrydrrssfsnygsvldifgpgtdilstwiggstrsisgtsmatphvaglaaylmtl
gkttaasacryiadtankgdlsnipfgtvnllaynnyqa

SCOPe Domain Coordinates for d5b1da_:

Click to download the PDB-style file with coordinates for d5b1da_.
(The format of our PDB-style files is described here.)

Timeline for d5b1da_: