| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
| Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
| Protein automated matches [190329] (10 species) not a true protein |
| Species Jararacussu (Bothrops jararacussu) [TaxId:8726] [326863] (1 PDB entry) |
| Domain d5f2qb_: 5f2q B: [327096] automated match to d1jzna_ complexed with ca, na |
PDB Entry: 5f2q (more details), 2.95 Å
SCOPe Domain Sequences for d5f2qb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5f2qb_ d.169.1.1 (B:) automated matches {Jararacussu (Bothrops jararacussu) [TaxId: 8726]}
nncpqdwlpmnglcykifnelkawkdaemfcrkykpgchlasihlygespeiaeyisdyh
kgqsevwiglcdkkkdfswewtdrsctdylswdknqpdhyqnkefcvelvsntgyrlwnd
qvcesknaflcqckf
Timeline for d5f2qb_: