Lineage for d5f2qj_ (5f2q J:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3001355Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 3001815Protein automated matches [190329] (10 species)
    not a true protein
  7. 3001867Species Jararacussu (Bothrops jararacussu) [TaxId:8726] [326863] (1 PDB entry)
  8. 3001877Domain d5f2qj_: 5f2q J: [327074]
    automated match to d1jzna_
    complexed with ca, na

Details for d5f2qj_

PDB Entry: 5f2q (more details), 2.95 Å

PDB Description: c-type lectin from bothrops jararacussu
PDB Compounds: (J:) C-type lectin BJcuL

SCOPe Domain Sequences for d5f2qj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f2qj_ d.169.1.1 (J:) automated matches {Jararacussu (Bothrops jararacussu) [TaxId: 8726]}
ncpqdwlpmnglcykifnelkawkdaemfcrkykpgchlasihlygespeiaeyisdyhk
gqsevwiglcdkkkdfswewtdrsctdylswdknqpdhyqnkefcvelvsntgyrlwndq
vcesknaflcqckf

SCOPe Domain Coordinates for d5f2qj_:

Click to download the PDB-style file with coordinates for d5f2qj_.
(The format of our PDB-style files is described here.)

Timeline for d5f2qj_: