Lineage for d1dp2a2 (1dp2 A:150-293)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 180820Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
  4. 180821Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (3 families) (S)
  5. 180835Family c.46.1.2: Sulfurtransferase (rhodanese) [52827] (2 proteins)
  6. 180836Protein Rhodanese [52828] (1 species)
  7. 180837Species Cow (Bos taurus) [TaxId:9913] [52829] (7 PDB entries)
  8. 180841Domain d1dp2a2: 1dp2 A:150-293 [32706]

Details for d1dp2a2

PDB Entry: 1dp2 (more details), 2.01 Å

PDB Description: crystal structure of the complex between rhodanese and lipoate

SCOP Domain Sequences for d1dp2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dp2a2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus)}
aifkatlnrsllktyeqvlenleskrfqlvdsraqgrylgtqpepdavgldsghirgsvn
mpfmnfltedgfekspeelramfeakkvdltkpliatcrkgvtachialaaylcgkpdva
iydgswfewfhrappetwvsqgkg

SCOP Domain Coordinates for d1dp2a2:

Click to download the PDB-style file with coordinates for d1dp2a2.
(The format of our PDB-style files is described here.)

Timeline for d1dp2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dp2a1