Lineage for d5hpja_ (5hpj A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2420906Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2420907Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2422210Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 2422211Protein automated matches [191011] (16 species)
    not a true protein
  7. 2422407Species Photobacterium profundum [TaxId:298386] [327045] (1 PDB entry)
  8. 2422408Domain d5hpja_: 5hpj A: [327046]
    automated match to d4ygfa_
    complexed with cl, zn

Details for d5hpja_

PDB Entry: 5hpj (more details), 1.5 Å

PDB Description: photobacterium profundum alpha-carbonic anhydrase
PDB Compounds: (A:) carbonic anhydrase

SCOPe Domain Sequences for d5hpja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hpja_ b.74.1.0 (A:) automated matches {Photobacterium profundum [TaxId: 298386]}
ewsytgehgtehwgdsfatcaegvnqtpidinqttqaelaplhldyegqvtelvnnghti
qanltgkntltvdgktfelkqfhfhtpsenylkgkqypleahfvhatdkgelavvavmfd
fgprsnnelttllasipskgqtvelkealnpadllprdreyyrfngslttppcsegvrwf
vmqepqtsskaqteklqavmgnnarplqplnarlile

SCOPe Domain Coordinates for d5hpja_:

Click to download the PDB-style file with coordinates for d5hpja_.
(The format of our PDB-style files is described here.)

Timeline for d5hpja_: