Class b: All beta proteins [48724] (178 folds) |
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) single sheet; 10 strands |
Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) |
Family b.74.1.0: automated matches [191576] (1 protein) not a true family |
Protein automated matches [191011] (16 species) not a true protein |
Species Photobacterium profundum [TaxId:298386] [327045] (1 PDB entry) |
Domain d5hpja_: 5hpj A: [327046] automated match to d4ygfa_ complexed with cl, zn |
PDB Entry: 5hpj (more details), 1.5 Å
SCOPe Domain Sequences for d5hpja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hpja_ b.74.1.0 (A:) automated matches {Photobacterium profundum [TaxId: 298386]} ewsytgehgtehwgdsfatcaegvnqtpidinqttqaelaplhldyegqvtelvnnghti qanltgkntltvdgktfelkqfhfhtpsenylkgkqypleahfvhatdkgelavvavmfd fgprsnnelttllasipskgqtvelkealnpadllprdreyyrfngslttppcsegvrwf vmqepqtsskaqteklqavmgnnarplqplnarlile
Timeline for d5hpja_: