| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
| Protein automated matches [226831] (73 species) not a true protein |
| Species Western balsam poplar (Populus trichocarpa) [TaxId:3694] [326861] (11 PDB entries) |
| Domain d5ey6a2: 5ey6 A:84-218 [326902] Other proteins in same PDB: d5ey6a1, d5ey6b1 automated match to d4ri6a2 |
PDB Entry: 5ey6 (more details), 1.9 Å
SCOPe Domain Sequences for d5ey6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ey6a2 a.45.1.0 (A:84-218) automated matches {Western balsam poplar (Populus trichocarpa) [TaxId: 3694]}
gdkglygtnplerasidqwveaegqsfgpssgalvfqlafaprmnipqdqgvikqneekl
gkvldiyeqrlgesrflagdeftfadlshlpngdylvnatdkghlftsrenvgrwwneis
dreswkkviemrksg
Timeline for d5ey6a2: