Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) |
Family c.79.1.0: automated matches [191338] (1 protein) not a true family |
Protein automated matches [190215] (38 species) not a true protein |
Species Lactobacillus plantarum [TaxId:220668] [326845] (1 PDB entry) |
Domain d5b1ha_: 5b1h A: [326865] automated match to d4lmaa_ complexed with gol, so4 |
PDB Entry: 5b1h (more details), 2.4 Å
SCOPe Domain Sequences for d5b1ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b1ha_ c.79.1.0 (A:) automated matches {Lactobacillus plantarum [TaxId: 220668]} mliqhvqelightplmalpievpnhshiyaklemfnpggsikdrlgayliedglqrgrvn akttiieptagntgiglalatqahhlrtilvvpekfsmekqvlmqalgaeivhtpseegi kgairkaealaatisnsyvpmqfknpanpaayyhtlapeiladmpapitafvagagsggt fagvaaylqaqdsatkavvvepegsilnggpahahrtegigvefippffdqvridqtlti adndafaqvrhlardhglligsssgaalaaslqlatnlpanshivtifpdsserylsqki ytk
Timeline for d5b1ha_: