Lineage for d5boze_ (5boz E:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2605913Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2605914Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2605915Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 2606016Protein Ricin A-chain [56389] (1 species)
  7. 2606017Species Castor bean (Ricinus communis) [TaxId:3988] [56390] (55 PDB entries)
    Uniprot P06750 28-286
  8. 2606082Domain d5boze_: 5boz E: [326843]
    Other proteins in same PDB: d5bozg_, d5bozh_, d5bozi_, d5bozj_, d5bozk_, d5bozl_
    automated match to d4lgsa_
    complexed with cl, so4

Details for d5boze_

PDB Entry: 5boz (more details), 3.1 Å

PDB Description: ricin a chain bound to camelid nanobody (vhh9)(e1)
PDB Compounds: (E:) ricin

SCOPe Domain Sequences for d5boze_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5boze_ d.165.1.1 (E:) Ricin A-chain {Castor bean (Ricinus communis) [TaxId: 3988]}
qypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvelsn
haelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggnyd
rleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaarfqyi
egemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvyd
vsilipiialmvyrcappp

SCOPe Domain Coordinates for d5boze_:

Click to download the PDB-style file with coordinates for d5boze_.
(The format of our PDB-style files is described here.)

Timeline for d5boze_: