SCOPe 2.06: Domain d5ty0a2: 5ty0 A:287-404

Lineage for d5ty0a2 (5ty0 A:287-404)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (7 families)

5. Family b.43.3.0: automated matches [227211] (1 protein)
   not a true family

6. Protein automated matches [226946] (26 species)
   not a true protein

7. Species Legionella pneumophila [TaxId:272624] [326819] (1 PDB entry)

8. Domain d5ty0a2: 5ty0 A:287-404 [326820]
   Other proteins in same PDB: d5ty0a1
   automated match to d2bv3a1
   complexed with bgc, na

Details for d5ty0a2

PDB Entry: 5ty0, 2.22 Å

PDB Description: 2.22 angstrom crystal structure of n-terminal fragment (residues 1- 419) of elongation factor g from legionella pneumophila.

PDB Compounds: (A:) Elongation factor G

SCOPe Domain Sequences for d5ty0a2:

Sequence; same for both SEQRES and ATOM records:

>d5ty0a2 b.43.3.0 (A:287-404) automated matches {Legionella pneumophila [TaxId: 272624]}
ptdipdiqgvdehgdvihrktsydepfsalafkiatdpfvgtltyfraysgilksgdtvy
nsvkgkkerigrllqmhansreeikevragdiaaavglktvttgdtlcdqdkvviler

Timeline for d5ty0a2:

• d5ty0a2 is new in SCOPe 2.06-stable
  
• d5ty0a2 appears in SCOPe 2.07
  
• d5ty0a2 appears in the current release, SCOPe 2.08