Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (156 species) not a true protein |
Species Legionella pneumophila [TaxId:272624] [261699] (4 PDB entries) |
Domain d5ty0a1: 5ty0 A:2-286 [326818] Other proteins in same PDB: d5ty0a2 automated match to d1efga2 complexed with bgc, na |
PDB Entry: 5ty0 (more details), 2.22 Å
SCOPe Domain Sequences for d5ty0a1:
Sequence, based on SEQRES records: (download)
>d5ty0a1 c.37.1.0 (A:2-286) automated matches {Legionella pneumophila [TaxId: 272624]} atplklyrnigiaahvdagkttttervlyytgmshkigevhdgaatmdwmvqeqergiti tsaattcywsgmdkqfeshriniidtpghvdfmieverslrvldgavvvfdsvagvepqs etvwrqankygvprivfvnkmdrmganflrvvsqikqrlgstpvvlqlpigaeeefkgvi dlikmkaihwdeenkgmtfkyvdipadlkstceeyrahiieaaaeyseelmekylegeef teaeikkalrhltitnkvvpvfcgsafknkgvqavldgvieylps
>d5ty0a1 c.37.1.0 (A:2-286) automated matches {Legionella pneumophila [TaxId: 272624]} atplklyrnigiaahvdagkttttervlyytgmshtsaattcywsgmdkqfeshriniid tpghvdfmieverslrvldgavvvfdsvagvepqsetvwrqankygvprivfvnkmdrmg anflrvvsqikqrlgstpvvlqlpigaeeefkgvidlikmkaihwdeenkgmtfkyvdip adlkstceeyrahiieaaaeyseelmekylegeefteaeikkalrhltitnkvvpvfcgs afknkgvqavldgvieylps
Timeline for d5ty0a1: