SCOP 1.71: Domain d1ptua_: 1ptu A:

Lineage for d1ptua_ (1ptu A:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (4 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (6 proteins)
   has an extension to the beta-sheet of 3 antiparallel strands before strand 4

6. Protein Tyrosine phosphatase [52806] (7 species)

7. Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (63 PDB entries)

8. Domain d1ptua_: 1ptu A: [32675]
   complexed with nh2, phs; mutant

Details for d1ptua_

PDB Entry: 1ptu, 2.6 Å

PDB Description: crystal structure of protein tyrosine phosphatase 1b complexed with phosphotyrosine-containing hexa-peptide (dadepyl-nh2)

SCOP Domain Sequences for d1ptua_:

Sequence; same for both SEQRES and ATOM records:

>d1ptua_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), 1B}
emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
aqywpqkeekemifedtnlkltlisediktyytvrqlelenlttqetreilhfhyttwpd
fgvpespasflnflfkvresgslspehgpvvvhssagigrsgtfcladtclllmdkrkdp
ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshed

Timeline for d1ptua_:

• d1ptua_ first appeared (with stable ids) in SCOP 1.55
  
• d1ptua_ appears in SCOP 1.69
  
• d1ptua_ appears in SCOP 1.73
  
• d1ptua_ appears in the current release, SCOPe 2.08