| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) ![]() form homo and heterodimers |
| Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins) |
| Protein RNA polymerase alpha [55259] (3 species) |
| Species Thermus thermophilus [TaxId:274] [75478] (15 PDB entries) Uniprot Q9Z9H6; part of multichain biological unit |
| Domain d5tmcb1: 5tmc B:1-49,B:173-238 [326576] Other proteins in same PDB: d5tmca2, d5tmcb2, d5tmcc_, d5tmcd_, d5tmce_, d5tmcf1, d5tmcf2, d5tmcf3 automated match to d1smya1 complexed with g4p, mg, po4, zn |
PDB Entry: 5tmc (more details), 2.71 Å
SCOPe Domain Sequences for d5tmcb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tmcb1 d.74.3.1 (B:1-49,B:173-238) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]}
mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqve
dtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpqaaavaapee
Timeline for d5tmcb1: