SCOPe 2.07: Domain d5hm4b_: 5hm4 B:

Lineage for d5hm4b_ (5hm4 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)

6. Protein automated matches [190140] (38 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [259690] (3 PDB entries)

8. Domain d5hm4b_: 5hm4 B: [326575]
   automated match to d4pfua_
   complexed with ca

Details for d5hm4b_

PDB Entry: 5hm4, 2 Å

PDB Description: crystal structure of oligopeptide abc transporter, periplasmic oligopeptide-binding protein (tm1226) from thermotoga maritima at 2.0 a resolution

PDB Compounds: (B:) Mannoside ABC transport system, sugar-binding protein

SCOPe Domain Sequences for d5hm4b_:

Sequence; same for both SEQRES and ATOM records:

>d5hm4b_ c.94.1.1 (B:) automated matches {Thermotoga maritima [TaxId: 243274]}
vlernetmyyggslwsppsnwnpftpwnavpgttglvyetmffydpltgnfdpwlaekge
wldsktyrvvlregiywhdnvpltsedvrftfeiakkykgihyssvwewldhietpdnrt
vifvfkdpryhewnellytlpivpkhiweekdettilqssneyplgsgpyvahswdqnkm
iferfenwwgtkvmgvkpapkyvvivrvlsnnvalgmlmkgeldfsnfmlpgvpilkkvy
nlntwydeppyhlsstvvglflnarkyplslpefrraiamsinadpivqrvyegavlkad
plgflpnsvwmkyypkevvekhgfkydpeeaksildklgfrdvngdgfretpdgkpiklt
iecpygwtdwmqaiqvivdqlkvvginaepyfpdsskyyenmykgefdiemnangtgiss
tpwtyfntifypdalesefsytgnygryqnpeveslleelnrtpldnvekvtelcgklge
illkdlpfiplwygamafitqdnvwtnwpnehnpyawpcgwanwwqtgalkilfnlkpak

Timeline for d5hm4b_:

• d5hm4b_ first appeared in SCOPe 2.06
  
• d5hm4b_ appears in the current release, SCOPe 2.08