![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
![]() | Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
![]() | Protein automated matches [226922] (95 species) not a true protein |
![]() | Species Amycolatopsis sp. [TaxId:37632] [226521] (6 PDB entries) |
![]() | Domain d5fjtc1: 5fjt C:1-125 [326548] Other proteins in same PDB: d5fjta2, d5fjtb2, d5fjtc2, d5fjtd2 automated match to d1sjda2 complexed with 5cr, mg; mutant |
PDB Entry: 5fjt (more details), 2.11 Å
SCOPe Domain Sequences for d5fjtc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fjtc1 d.54.1.0 (C:1-125) automated matches {Amycolatopsis sp. [TaxId: 37632]} mklsgvelrrvqmplvapfrtsfgtqsvrellllravtpagegwgecvtmagplysseyn dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa aelgs
Timeline for d5fjtc1: