SCOPe 2.08: Domain d5fjta1: 5fjt A:1-125

Lineage for d5fjta1 (5fjt A:1-125)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Amycolatopsis sp. [TaxId:37632] [226521] (6 PDB entries)

8. Domain d5fjta1: 5fjt A:1-125 [326474]
   Other proteins in same PDB: d5fjta2, d5fjtb2, d5fjtc2, d5fjtd2
   automated match to d1sjda2
   complexed with 5cr, mg; mutant

Details for d5fjta1

PDB Entry: 5fjt, 2.11 Å

PDB Description: n-acyl amino acid racemase from amycolatopsis sp. ts-1-60: g291d f323 mutant in complex with n-acetyl phenylalanine

PDB Compounds: (A:) o-succinylbenzoate synthase

SCOPe Domain Sequences for d5fjta1:

Sequence; same for both SEQRES and ATOM records:

>d5fjta1 d.54.1.0 (A:1-125) automated matches {Amycolatopsis sp. [TaxId: 37632]}
mklsgvelrrvqmplvapfrtsfgtqsvrellllravtpagegwgecvtmagplysseyn
dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
aelgs

Timeline for d5fjta1:

• d5fjta1 first appeared in SCOPe 2.06
  
• d5fjta1 appears in SCOPe 2.07