SCOPe 2.06: Domain d5tf1l2: 5tf1 L:103-207

Lineage for d5tf1l2 (5tf1 L:103-207)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)

8. Domain d5tf1l2: 5tf1 L:103-207 [326370]
   Other proteins in same PDB: d5tf1l1
   automated match to d1dn0a2

Details for d5tf1l2

PDB Entry: 5tf1, 1.86 Å

PDB Description: structure of chimeric 02-cc fab, a vrc01-like germline antibody

PDB Compounds: (L:) O2-CC Fab Light Chain

SCOPe Domain Sequences for d5tf1l2:

Sequence; same for both SEQRES and ATOM records:

>d5tf1l2 b.1.1.2 (L:103-207) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d5tf1l2:

• d5tf1l2 is new in SCOPe 2.06-stable
  
• d5tf1l2 appears in SCOPe 2.07
  
• d5tf1l2 appears in the current release, SCOPe 2.08