Lineage for d5kr2a_ (5kr2 A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. Protein Human immunodeficiency virus type 1 protease [50632] (9 species)
  7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (578 PDB entries)
    Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167
  8. Domain d5kr2a_: 5kr2 A: [326290]
    automated match to d3bvaa_
    complexed with roc

Details for d5kr2a_

PDB Entry: 5kr2 (more details), 1.7800000000000002 Å

PDB Description: protease pr5-sqv
PDB Compounds: (A:) Protease PR5-SQV

SCOPe Domain Sequences for d5kr2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kr2a_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtikvggqlkeallntgaddtviedmnlpgkwkpkmiggiggfikvkqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

SCOPe Domain Coordinates for d5kr2a_ are not available.

Timeline for d5kr2a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5kr2b_, d5kr2c_, d5kr2d_