SCOPe 2.06: Domain d5hgrb2: 5hgr B:176-317

Lineage for d5hgrb2 (5hgr B:176-317)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.0: automated matches [191337] (1 protein)
   not a true family

6. Protein automated matches [190205] (26 species)
   not a true protein

7. Species Nostoc sp. [TaxId:103690] [326234] (1 PDB entry)

8. Domain d5hgrb2: 5hgr B:176-317 [326248]
   Other proteins in same PDB: d5hgra1, d5hgrb1
   automated match to d1m98a2
   complexed with 45d

Details for d5hgrb2

PDB Entry: 5hgr, 1.68 Å

PDB Description: structure of anabaena (nostoc) sp. pcc 7120 orange carotenoid protein binding canthaxanthin

PDB Compounds: (B:) Orange Carotenoid Protein (OCP)

SCOPe Domain Sequences for d5hgrb2:

Sequence; same for both SEQRES and ATOM records:

>d5hgrb2 d.17.4.0 (B:176-317) automated matches {Nostoc sp. [TaxId: 103690]}
eplvapkdisqrvqvtieginnstvlnymnnlnandfdeliklfvedgalqppfqrpivg
kdailrffreecqnlnllpergvaepaddgytqvkvtgkvqtpwfgaavgmnmawrflln
pqgkiffvaidllaspkellnl

Timeline for d5hgrb2:

• d5hgrb2 is new in SCOPe 2.06-stable
  
• d5hgrb2 appears in SCOPe 2.07
  
• d5hgrb2 appears in the current release, SCOPe 2.08