Lineage for d5l64e_ (5l64 E:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2230570Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2230571Protein automated matches [190509] (14 species)
    not a true protein
  7. 2230621Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (91 PDB entries)
  8. 2230798Domain d5l64e_: 5l64 E: [326099]
    Other proteins in same PDB: d5l64a_, d5l64b_, d5l64f_, d5l64g_, d5l64h_, d5l64i_, d5l64j_, d5l64k_, d5l64l_, d5l64m_, d5l64n_, d5l64o_, d5l64p_, d5l64t_, d5l64u_, d5l64v_, d5l64w_, d5l64x_, d5l64y_, d5l64z_
    automated match to d4g4se_
    complexed with 6nv, cl, mes, mg

Details for d5l64e_

PDB Entry: 5l64 (more details), 2.7 Å

PDB Description: yeast 20s proteasome with human beta5c (1-138) and human beta6 (97- 111; 118-133) in complex with epoxyketone inhibitor 18
PDB Compounds: (E:) Proteasome subunit alpha type-6

SCOPe Domain Sequences for d5l64e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l64e_ d.153.1.0 (E:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
nnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqkki
ikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntqsy
ggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfikid
gnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi

SCOPe Domain Coordinates for d5l64e_:

Click to download the PDB-style file with coordinates for d5l64e_.
(The format of our PDB-style files is described here.)

Timeline for d5l64e_: