SCOPe 2.07: Domain d5trob1: 5tro B:61-242

Lineage for d5trob1 (5tro B:61-242)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
   unusual fold

4. Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families)
   automatically mapped to Pfam PF03717

5. Family d.175.1.0: automated matches [227232] (1 protein)
   not a true family

6. Protein automated matches [226981] (13 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93062] [326092] (1 PDB entry)

8. Domain d5trob1: 5tro B:61-242 [326093]
   Other proteins in same PDB: d5troa2, d5trob2
   automated match to d4oola1
   complexed with cl

Details for d5trob1

PDB Entry: 5tro, 1.8 Å

PDB Description: 1.8 angstrom resolution crystal structure of dimerization and transpeptidase domains (residues 39-608) of penicillin-binding protein 1 from staphylococcus aureus.

PDB Compounds: (B:) Penicillin-binding protein 1

SCOPe Domain Sequences for d5trob1:

Sequence, based on SEQRES records:

>d5trob1 d.175.1.0 (B:61-242) automated matches {Staphylococcus aureus [TaxId: 93062]}
qqpergkiydrngkvlaedveryklvavidkkasanskkprhvvdkketakklstvinmk
peeiekrlsqkkafqiefgrkgtnltyqdklkiekmnlpgisllpeterfypngnfashl
igraqknpdtgelkgalgvekifdsylsgskgslryihdiwgyiapntkkekqpkrgddv
hl

Sequence, based on observed residues (ATOM records):

>d5trob1 d.175.1.0 (B:61-242) automated matches {Staphylococcus aureus [TaxId: 93062]}
qqpergkiydrngkvlaedveryklvavidkkasanskkprhvvdkketakklstvinmk
peeiekrlsqkkafqiefgrkgtnltyqdklkiekmnlpgisllpeterfypngnfashl
igraqknpdtgelkgalgvekifdsylsgskkrgddvhl

Timeline for d5trob1:

• d5trob1 first appeared in SCOPe 2.06
  
• d5trob1 appears in the current release, SCOPe 2.08