Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (19 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries) |
Domain d5l6bs_: 5l6b S: [325662] Other proteins in same PDB: d5l6ba_, d5l6bb_, d5l6bf_, d5l6bg_, d5l6bh_, d5l6bi_, d5l6bj_, d5l6bk_, d5l6bl_, d5l6bm_, d5l6bn_, d5l6bo_, d5l6bp_, d5l6bt_, d5l6bu_, d5l6bv_, d5l6bw_, d5l6bx_, d5l6by_, d5l6bz_ automated match to d4g4se_ complexed with 04c, cl, mes, mg |
PDB Entry: 5l6b (more details), 2.6 Å
SCOPe Domain Sequences for d5l6bs_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l6bs_ d.153.1.0 (S:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} nnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqkki ikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntqsy ggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfikid gnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
Timeline for d5l6bs_: