Lineage for d1d3va_ (1d3v A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2873861Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2873862Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2873863Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins)
    Pfam PF00491
  6. 2873884Protein Arginase [52770] (5 species)
  7. 2874027Species Norway rat (Rattus norvegicus) [TaxId:10116] [52771] (34 PDB entries)
    Uniprot P07824
  8. 2874028Domain d1d3va_: 1d3v A: [32559]
    complexed with abh, mn

Details for d1d3va_

PDB Entry: 1d3v (more details), 1.7 Å

PDB Description: crystal structure of the binuclear manganese metalloenzyme arginase complexed with 2(s)-amino-6-boronohexanoic acid, an l-arginine analog
PDB Compounds: (A:) protein (arginase)

SCOPe Domain Sequences for d1d3va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d3va_ c.42.1.1 (A:) Arginase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kpieiigapfskgqprggvekgpaalrkaglveklketeynvrdhgdlafvdvpndspfq
ivknprsvgkaneqlaavvaetqkngtisvvlggdhsmaigsisgharvhpdlcviwvda
htdintplttssgnlhgqpvafllkelkgkfpdvpgfswvtpcisakdivyiglrdvdpg
ehyiiktlgikyfsmtevdklgigkvmeetfsyllgrkkrpihlsfdvdgldpvftpatg
tpvvgglsyreglyiteeiyktgllsgldimevnptlgktpeevtrtvntavaltlscfg
tkregnhk

SCOPe Domain Coordinates for d1d3va_:

Click to download the PDB-style file with coordinates for d1d3va_.
(The format of our PDB-style files is described here.)

Timeline for d1d3va_: