Lineage for d1d3va_ (1d3v A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.42: Arginase/deacetylase [52767] (1 superfamily) Superfamily c.42.1: Arginase/deacetylase [52768] (2 families) 
Family c.42.1.1: Arginase [52769] (1 protein) Protein Arginase [52770] (2 species) Species Rat (Rattus norvegicus) [TaxId:10116] [52771] (6 PDB entries) 
Domain d1d3va_: 1d3v A: [32559]
Details for d1d3va_
PDB Entry: 1d3v (more details), 1.7 Å
PDB Description: crystal structure of the binuclear manganese metalloenzyme arginase complexed with 2(s)-amino-6-boronohexanoic acid, an l-arginine analog
SCOP Domain Sequences for d1d3va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d3va_ c.42.1.1 (A:) Arginase {Rat (Rattus norvegicus)}
kpieiigapfskgqprggvekgpaalrkaglveklketeynvrdhgdlafvdvpndspfq
ivknprsvgkaneqlaavvaetqkngtisvvlggdhsmaigsisgharvhpdlcviwvda
htdintplttssgnlhgqpvafllkelkgkfpdvpgfswvtpcisakdivyiglrdvdpg
ehyiiktlgikyfsmtevdklgigkvmeetfsyllgrkkrpihlsfdvdgldpvftpatg
tpvvgglsyreglyiteeiyktgllsgldimevnptlgktpeevtrtvntavaltlscfg
tkregnhk
SCOP Domain Coordinates for d1d3va_:
Click to download the PDB-style file with coordinates for d1d3va_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1d3va_:
- d1d3va_ appears in SCOP 1.57
- d1d3va_ appears in the current release, SCOPe 2.08
View in 3D
