SCOPe 2.08: Domain d5l5rq1: 5l5r Q:1-234

Lineage for d5l5rq1 (5l5r Q:1-234)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.0: automated matches [191393] (1 protein)
   not a true family

6. Protein automated matches [190509] (19 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries)

8. Domain d5l5rq1: 5l5r Q:1-234 [325375]
   Other proteins in same PDB: d5l5ra_, d5l5rb_, d5l5rc2, d5l5rf_, d5l5rg_, d5l5rh_, d5l5ri_, d5l5rj_, d5l5rk_, d5l5rl_, d5l5rm_, d5l5rn_, d5l5ro_, d5l5rp_, d5l5rq2, d5l5rt_, d5l5ru_, d5l5rv_, d5l5rw_, d5l5rx_, d5l5ry_, d5l5rz_
   automated match to d1iruf_
   complexed with cl, mg

Details for d5l5rq1

PDB Entry: 5l5r, 2.9 Å

PDB Description: yeast 20s proteasome with human beta5i (1-138;v31m) and human beta6 (97-111; 118-133)

PDB Compounds: (Q:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d5l5rq1:

Sequence; same for both SEQRES and ATOM records:

>d5l5rq1 d.153.1.0 (Q:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi

Timeline for d5l5rq1:

• d5l5rq1 first appeared in SCOPe 2.06, called d5l5rq_
  
• d5l5rq1 was called d5l5rq_ in SCOPe 2.07