Lineage for d5glua1 (5glu A:2-144)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2390272Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2390273Protein automated matches [190437] (66 species)
    not a true protein
  7. 2391009Species Toxascaris leonina [TaxId:59264] [256287] (7 PDB entries)
  8. 2391038Domain d5glua1: 5glu A:2-144 [325006]
    Other proteins in same PDB: d5glua3, d5glub3
    automated match to d4hl0a1
    complexed with gal, glc, sia

Details for d5glua1

PDB Entry: 5glu (more details), 2.1 Å

PDB Description: tl-gal with sialac
PDB Compounds: (A:) galectin

SCOPe Domain Sequences for d5glua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5glua1 b.29.1.0 (A:2-144) automated matches {Toxascaris leonina [TaxId: 59264]}
atetnypvpyrskltepfepgqtliikgktaedsvrftinlhntsadfsgndvplhisvr
fdegkivfntfskgewgkeerksnpykkgddidirirahdskfsisvdqkevkeyehrvp
lssvthfsvdgdilityihwggk

SCOPe Domain Coordinates for d5glua1:

Click to download the PDB-style file with coordinates for d5glua1.
(The format of our PDB-style files is described here.)

Timeline for d5glua1: