Lineage for d1sela_ (1sel A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1598715Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 1598716Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 1598717Family c.41.1.1: Subtilases [52744] (14 proteins)
  6. 1598785Protein Subtilisin [52745] (6 species)
  7. 1598874Species Bacillus subtilis, carlsberg [TaxId:1423] [52746] (8 PDB entries)
  8. 1598878Domain d1sela_: 1sel A: [32483]
    complexed with ca

Details for d1sela_

PDB Entry: 1sel (more details), 2 Å

PDB Description: crystal structure of selenosubtilisin at 2.0-angstroms resolution
PDB Compounds: (A:) selenosubtilisin

SCOPe Domain Sequences for d1sela_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sela_ c.41.1.1 (A:) Subtilisin {Bacillus subtilis, carlsberg [TaxId: 1423]}
aqtvpygiplikadkvqaqgfkganvkvavldtgiqashpdlnvvggasfvageayntdg
nghgthvagtvaaldnttgvlgvapsvslyavkvlnssgsgsysgivsgiewattngmdv
inmslggasgstamkqavdnayargvvvvaaagnsgnsgstntigypakydsviavgavd
snsnrasfssvgaelevmapgagvystyptntyatlngtxmasphvagaaalilskhpnl
sasqvrnrlsstatylgssfyygkglinveaaaq

SCOPe Domain Coordinates for d1sela_:

Click to download the PDB-style file with coordinates for d1sela_.
(The format of our PDB-style files is described here.)

Timeline for d1sela_: