| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (165 species) not a true protein |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [196344] (16 PDB entries) |
| Domain d5ecob1: 5eco B:4-83 [324829] Other proteins in same PDB: d5ecob2, d5ecoc2, d5ecoe2, d5ecof2 automated match to d3fhsa3 complexed with gsh, jaa, leu, mg |
PDB Entry: 5eco (more details), 1.8 Å
SCOPe Domain Sequences for d5ecob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ecob1 c.47.1.0 (B:4-83) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lpilldywpsmfgmrarvalrekgvefeyreedfsnksplllqsnpihkkipvlvhngkp
vceslnvvqyvdeawpeknp
Timeline for d5ecob1: