SCOPe 2.07: Domain d5kzua1: 5kzu A:1-206

Lineage for d5kzua1 (5kzu A:1-206)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (5 species)
   not a true protein

7. Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries)

8. Domain d5kzua1: 5kzu A:1-206 [324796]
   Other proteins in same PDB: d5kzua2, d5kzub2, d5kzuc2, d5kzud2, d5kzue2
   automated match to d2w8gc_
   complexed with 74s, pg4, so4

Details for d5kzua1

PDB Entry: 5kzu, 2.3 Å

PDB Description: crystal structure of an acetylcholine binding protein from aplysia californica (ac-achbp) in complex with click chemistry compound 9- [[1-[8-methyl-8-(2-phenylethyl)-8-azoniabicyclo[3.2.1]octan-3- yl]triazol-4-yl]methyl]carbazole

PDB Compounds: (A:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d5kzua1:

Sequence, based on SEQRES records:

>d5kzua1 b.96.1.0 (A:1-206) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qtrqvqhysccpepyidvnlvvkfre

Sequence, based on observed residues (ATOM records):

>d5kzua1 b.96.1.0 (A:1-206) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrpmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrwk
lnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaq
rlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatq
trqvqhysccpepyidvnlvvkfre

Timeline for d5kzua1:

• d5kzua1 first appeared in SCOPe 2.06
  
• d5kzua1 appears in the current release, SCOPe 2.08