Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) |
Family c.1.18.0: automated matches [191539] (1 protein) not a true family |
Protein automated matches [190919] (11 species) not a true protein |
Species Bacillus subtilis [TaxId:224308] [324756] (3 PDB entries) |
Domain d5t9bg_: 5t9b G: [324757] automated match to d2pz0b_ complexed with ca, g3p, na |
PDB Entry: 5t9b (more details), 1.62 Å
SCOPe Domain Sequences for d5t9bg_:
Sequence, based on SEQRES records: (download)
>d5t9bg_ c.1.18.0 (G:) automated matches {Bacillus subtilis [TaxId: 224308]} nllspdriltvahrgasgyvpehtilsyetaqkmkadfieldlqmtkdgklivmhdekld rttngmgwvkdhtladikkldagswfneaypekakpqyvglkvptleevldrfgkhanyy ietkspdtypgmeekliaslqkhkllgkhskpgqviiqsfskeslvkvhqlqpnlptvql leakqmasmtdaaleeiktyavgagpdykalnqenvrmirshglllhpytvnneadmhrl ldwgvtgvftnypdlfhkvkkgy
>d5t9bg_ c.1.18.0 (G:) automated matches {Bacillus subtilis [TaxId: 224308]} nllspdriltvahrgasgyvpehtilsyetaqkmkadfieldlqmtkdgklivmhdekld rttngmgwvkdhtladikkldagswfneaypekakpqyvglkvptleevldrfgkhanyy ietkspdtypgmeekliaslqkhkllkpgqviiqsfskeslvkvhqlqpnlptvqlleak qmasmtdaaleeiktyavgagpdykalnqenvrmirshglllhpytvnneadmhrlldwg vtgvftnypdlfhkvkkgy
Timeline for d5t9bg_: