SCOPe 2.06: Domain d4zjba_: 4zjb A:

Lineage for d4zjba_ (4zjb A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.6: FabZ-like [110902] (1 protein)
   automatically mapped to Pfam PF07977

6. Protein (3R)-hydroxymyristoyl ACP dehydrase FabZ [110903] (3 species)

7. Species Helicobacter pylori [TaxId:210] [188573] (16 PDB entries)

8. Domain d4zjba_: 4zjb A: [324755]
   Other proteins in same PDB: d4zjbg1, d4zjbg2
   automated match to d2glla_
   complexed with cit, pns

Details for d4zjba_

PDB Entry: 4zjb, 2.55 Å

PDB Description: crystal structure of (3r)-hydroxyacyl-acyl carrier protein dehydratase(fabz) in complex with holo-acp from helicobacter pylori

PDB Compounds: (A:) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ

SCOPe Domain Sequences for d4zjba_:

Sequence; same for both SEQRES and ATOM records:

>d4zjba_ d.38.1.6 (A:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Helicobacter pylori [TaxId: 210]}
qsqffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfpnkpifpgv
livegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrleyhlevlkh
kgmiwqvggtaqvdgkvvaeaelkamiaer

Timeline for d4zjba_:

• d4zjba_ is new in SCOPe 2.06-stable
  
• d4zjba_ appears in SCOPe 2.07
  
• d4zjba_ appears in the current release, SCOPe 2.08