Lineage for d1blea_ (1ble A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114853Fold c.38: PTS IIb component [52727] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 6 strands, order 324156
  4. 2114854Superfamily c.38.1: PTS IIb component [52728] (2 families) (S)
  5. 2114855Family c.38.1.1: PTS IIb component [52729] (2 protein domains)
    automatically mapped to Pfam PF03830
  6. 2114856Protein Fructose permease, subunit IIb [52730] (1 species)
  7. 2114857Species Bacillus subtilis [TaxId:1423] [52731] (1 PDB entry)
  8. 2114858Domain d1blea_: 1ble A: [32475]

Details for d1blea_

PDB Entry: 1ble (more details), 2.9 Å

PDB Description: phosphoenolpyruvate-dependent phosphotransferase system
PDB Compounds: (A:) fructose permease

SCOPe Domain Sequences for d1blea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1blea_ c.38.1.1 (A:) Fructose permease, subunit IIb {Bacillus subtilis [TaxId: 1423]}
mnivlariddrfihgqiltrwikvhaadriivvsddiaqdemrktlilsvapsnvkasav
svskmakafhspryegvtamllfenpsdivslieagvpiktvnvggmrfenhrrqitksv
svteqdikafetlsdkgvklelrqlpsdasedfvqilrnvt

SCOPe Domain Coordinates for d1blea_:

Click to download the PDB-style file with coordinates for d1blea_.
(The format of our PDB-style files is described here.)

Timeline for d1blea_: