SCOPe 2.08: Domain d1blea_: 1ble A:

Lineage for d1blea_ (1ble A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.38: PTS IIb component [52727] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 6 strands, order 324156

4. Superfamily c.38.1: PTS IIb component [52728] (2 families)

5. Family c.38.1.1: PTS IIb component [52729] (2 proteins)
   automatically mapped to Pfam PF03830

6. Protein Fructose permease, subunit IIb [52730] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [52731] (1 PDB entry)

8. Domain d1blea_: 1ble A: [32475]

Details for d1blea_

PDB Entry: 1ble, 2.9 Å

PDB Description: phosphoenolpyruvate-dependent phosphotransferase system

PDB Compounds: (A:) fructose permease

SCOPe Domain Sequences for d1blea_:

Sequence; same for both SEQRES and ATOM records:

>d1blea_ c.38.1.1 (A:) Fructose permease, subunit IIb {Bacillus subtilis [TaxId: 1423]}
mnivlariddrfihgqiltrwikvhaadriivvsddiaqdemrktlilsvapsnvkasav
svskmakafhspryegvtamllfenpsdivslieagvpiktvnvggmrfenhrrqitksv
svteqdikafetlsdkgvklelrqlpsdasedfvqilrnvt

Timeline for d1blea_:

• d1blea_ first appeared (with stable ids) in SCOP 1.55, called d1ble__
  
• d1blea_ appears in SCOPe 2.07